PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS62629.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family GRAS
Protein Properties Length: 693aa    MW: 77862 Da    PI: 5.0081
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS62629.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS348.79.2e-1073196901373
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                 l++lL++cA+ v+++d + a + L  + +++sp+gd+ qRla++f+ +L+arl ++++ely++l+ ++ s     e+l+a++++  ++P+ k+    aN
  EPS62629.1 319 LRTLLISCAQSVAADDRRTAYEQLMLIDQHSSPTGDAYQRLAHVFATGLRARLCGTGTELYASLSQRKIS---AFEKLKAYQVYLCACPFKKLPMSFAN 414
                 6789***********************************************************9999998...9************************* PP

        GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  +I  a++ ++++Hi+Df+i +G+QWpa++q L+ Rp+gpp+lRiTgv+ p++g   +e++ etg+rL+++++++gv+fe++++v +++e+++le++++
  EPS62629.1 415 MMIGSALADASKLHIVDFGILYGFQWPAIIQCLSLRPGGPPKLRITGVELPQPGfkPEERVMETGRRLKNYCDRFGVSFEYQAIVRQSWESIKLEDFKI 513
                 *****************************************************999******************************************* PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                  ++E+laVn+ ++  rllde+v ++s+rd++Lkl+++++P+++v +    +++++ F++rf eal +ysalfd+++a++pr+s er+  E+e+lgre++
  EPS62629.1 514 ASDEVLAVNCLFRFGRLLDETVIVDSPRDALLKLIRKMKPDLFVNAVISGSYSAPFFVTRFKEALFHYSALFDMFDANIPRDSPERMDFEQEFLGREVM 612
                 *************************************************************************************************** PP

        GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                 nv+acegaer+er et+++W++r  +aGFkp+pl+  ++++ +   +  + + +  +e  ++++lgWk+r + + S+W
  EPS62629.1 613 NVIACEGAERVERPETYKQWHARHVRAGFKPLPLNRPIMEKLRGKCKAGYHRDFLFDEGGNWMLLGWKGRIICASSCW 690
                 **********************************************9999889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.132293671IPR005202Transcription factor GRAS
PfamPF035143.2E-104319690IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 693 aa     Download sequence    Send to blast
MDPRLSEMST AVNGFKLENG NFSSSLGQLP YLDDGINHDL GLDDFDIPFF AVTPEIDSFG  60
PSSTTSYETR SPDDLESDEV LKFFNQILVE ENTEEKFSMF HDPLALRDAE KSLYEVIGQK  120
YPPSPYNTVA YINQTSDSPE SIIESSSGYS TSSNTGNSSM HPQLINIFSN SDSILQFKKG  180
MEEASKFLPI NNHLIIDLEK YALPEKSDDI THSADVVAEQ DEAGDSSYSG RGRKHNFPED  240
KYSERLERSS KQSATSVEEV ELSEYFEKVL LCSEVAGCGG DAKSPIVEKP SSQEILLAKD  300
SNLKSRGKKS DSDGETVDLR TLLISCAQSV AADDRRTAYE QLMLIDQHSS PTGDAYQRLA  360
HVFATGLRAR LCGTGTELYA SLSQRKISAF EKLKAYQVYL CACPFKKLPM SFANMMIGSA  420
LADASKLHIV DFGILYGFQW PAIIQCLSLR PGGPPKLRIT GVELPQPGFK PEERVMETGR  480
RLKNYCDRFG VSFEYQAIVR QSWESIKLED FKIASDEVLA VNCLFRFGRL LDETVIVDSP  540
RDALLKLIRK MKPDLFVNAV ISGSYSAPFF VTRFKEALFH YSALFDMFDA NIPRDSPERM  600
DFEQEFLGRE VMNVIACEGA ERVERPETYK QWHARHVRAG FKPLPLNRPI MEKLRGKCKA  660
GYHRDFLFDE GGNWMLLGWK GRIICASSCW VPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-483236908374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089502.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLS8C7680.0S8C768_9LAMI; Uncharacterized protein
STRINGSolyc06g076280.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]